Anti-C12orf24 antibody
| Name | Anti-C12orf24 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81771 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Cat |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (PPAVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTP Q) of Human C12orf24 (NP_037432) |
| Description | Rabbit Polyclonal |
| Gene | FAM216A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C12orf24 antibody (ab81771) at 1 µg/ml + Fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution