Name | Anti-C12ORF4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab102615 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 71-120 (EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEP S) of Human C12ORF4 (NP_065107) |
Description | Rabbit Polyclonal |
Gene | C12orf4 |
Conjugate | Unconjugated |
Supplier Page | Shop |