| Name | Anti-C12ORF4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102615 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 71-120 (EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEP S) of Human C12ORF4 (NP_065107) |
| Description | Rabbit Polyclonal |
| Gene | C12orf4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |