Anti-C16orf65 antibody
| Name | Anti-C16orf65 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90161 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 72-121 ( STPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISIS ) of Human C16orf65 (NP_776167) |
| Description | Rabbit Polyclonal |
| Gene | PDZD9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C16orf65 antibody (ab90161) at 1 µg/ml + Fetal small intestine lysate (Human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution