Name | Anti-C16orf78 antibody |
---|---|
Supplier | Abcam |
Catalog | ab83013 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 107-156 (GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIV L) of Human C16orf78, NP_653203 |
Description | Rabbit Polyclonal |
Gene | C16orf78 |
Conjugate | Unconjugated |
Supplier Page | Shop |