Anti-C16orf78 antibody
| Name | Anti-C16orf78 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83013 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 107-156 (GVEQKGKHLSMVPGSYIKDGPKKSDTDIKDAVDPESTQRPNPFRRQSIV L) of Human C16orf78, NP_653203 |
| Description | Rabbit Polyclonal |
| Gene | C16orf78 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C16orf78 antibody (ab83013) at 1 µg/ml + Fetal lung lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution