Anti-C16orf9 antibody
| Name | Anti-C16orf9 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102585 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 431-480, RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA of Human C16orf9 (NP_114428) |
| Description | Rabbit Polyclonal |
| Gene | ITFG3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C16orf9 antibody (ab102585) at 1 µg/ml + MCF7 cell lysate at 10 µg