Anti-C17orf64 antibody
| Name | Anti-C17orf64 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98061 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 186-235 ( NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE ) of Human C17orf64 (NP_859058) |
| Description | Rabbit Polyclonal |
| Gene | C17orf64 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C17orf64 antibody (ab98061) at 1 µg/ml (in 5% skim milk / PBS buffer) + PANC1 Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution