Anti-C18orf54 antibody
| Name | Anti-C18orf54 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81233 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Rat, Horse, Guinea Pig, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 253-302 (NSDDSPQQTSRAKSAKGVLEDFLNNDNQSCTLSGGKHHGPVEALKQMLF N) of Human C18orf54, EAW63006 |
| Description | Rabbit Polyclonal |
| Gene | C18orf54 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C18orf54 antibody (ab81233) at 1 µg/ml (in 5% skim milk / PBS buffer) + Hela cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution