Name | Anti-C1orf110 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87742 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (KVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED V) of human C1orf110 (NP_848645) |
Description | Rabbit Polyclonal |
Gene | C1orf110 |
Conjugate | Unconjugated |
Supplier Page | Shop |