Anti-C1orf110 antibody
| Name | Anti-C1orf110 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87742 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (KVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED V) of human C1orf110 (NP_848645) |
| Description | Rabbit Polyclonal |
| Gene | C1orf110 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C1orf110 antibody (ab87742) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution