Anti-C1orf131 antibody

Name Anti-C1orf131 antibody
Supplier Abcam
Catalog ab102612
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPS V) of Human C1orf131, isoform 2 (NP_689592)
Description Rabbit Polyclonal
Gene C1orf131
Conjugate Unconjugated
Supplier Page Shop