Name | Anti-C1orf131 antibody |
---|---|
Supplier | Abcam |
Catalog | ab102612 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 (TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPS V) of Human C1orf131, isoform 2 (NP_689592) |
Description | Rabbit Polyclonal |
Gene | C1orf131 |
Conjugate | Unconjugated |
Supplier Page | Shop |