Anti-C1orf177 antibody
| Name | Anti-C1orf177 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87303 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Horse, Bovine |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN L) of Human C1orf177 (NP_689820) |
| Description | Rabbit Polyclonal |
| Gene | C1orf177 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C1orf177 antibody (ab87303) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryanti-Rabbit IgG HRP at 1/50000 dilution