Name | Anti-C1orf177 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87303 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rabbit, Horse, Bovine |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN L) of Human C1orf177 (NP_689820) |
Description | Rabbit Polyclonal |
Gene | C1orf177 |
Conjugate | Unconjugated |
Supplier Page | Shop |