Anti-C1orf19 antibody
| Name | Anti-C1orf19 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122934 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Dog, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 109-158 ( ASLSHNRIREILKASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFML ) of Mouse C1orf19 (NP_079953) |
| Description | Rabbit Polyclonal |
| Gene | TSEN15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C1orf19 antibody (ab122934) at 1 µg/ml + Mouse Spleen lysate at 10 µg