Anti-C1orf76 antibody
| Name | Anti-C1orf76 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab22139 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | Fusion protein: SPYSSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPSLKLAAPQSYPVT WPGSGREAFTNPRAISTDV , corresponding to amino acids 99/167 of Human C1orf76 Run BLAST with Run BLAST with |
| Description | Mouse Polyclonal |
| Gene | FAM163A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-C1orf76 antibody (ab22139) at 1/1000 dilutionLane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ugLane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ugSecondaryRabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution