Anti-C1orf96 antibody
| Name | Anti-C1orf96 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102623 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 179-228 ( ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK ) of Human C1orf96 (NP_660300) |
| Description | Rabbit Polyclonal |
| Gene | CCSAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C1orf96 antibody (ab102623) at 1 µg/ml + Human fetal heart lysate at 10 µg