Anti-C21orf2 antibody
| Name | Anti-C21orf2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84341 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2-51 ( KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS ) of Human C21orf2 (NP_004919) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | C21orf2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C21orf2 antibody (ab84341) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution