Anti-C4orf19 antibody
| Name | Anti-C4orf19 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108087 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 1-50 ( MGCRCCKIIQSYLFDPVQVPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVL ) of human C4orf19 (NP_060772) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | C4orf19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C4orf19 antibody (ab108087) at 1 µg/ml + COLO205 cell lysate