Anti-C4orf33 antibody
| Name | Anti-C4orf33 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105864 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 127-176 ( PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF ) of Human C4orf33 (NP_001093253) |
| Description | Rabbit Polyclonal |
| Gene | C4orf33 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C4orf33 antibody (ab105864) at 0.5 µg/ml + Jurkat cell lysate at 10 µg