Anti-C7ORF61 antibody
| Name | Anti-C7ORF61 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128343 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Guinea Pig |
| Antigen | Synthetic peptide, corresponding to a region within C-terminal amino acids 138-187 ( SSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCH ) of Human C7ORF61 (NP_001004323) |
| Description | Rabbit Polyclonal |
| Gene | C7orf61 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C7ORF61 antibody (ab128343) at 1 µg/ml + Jurkat cell lysate at 10 µg