Anti-C9orf152 antibody
| Name | Anti-C9orf152 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab101976 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 ( MEGLPCPCPALPHFWQLRSHLMAEGSRTQAPGKGPPLSIQFLRAQYEGLK ) of Human C9orf152 (NP_001374) |
| Description | Rabbit Polyclonal |
| Gene | C9orf152 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C9orf152 antibody (ab101976) at 1 µg/ml + THP-1 cell lysate at 10 µgdeveloped using the ECL technique