Name | Anti-C9orf85 antibody |
---|---|
Supplier | Abcam |
Catalog | ab122955 |
Prices | $359.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 39-88 (KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCR P) of Mouse C9orf85 (NP_079699) |
Description | Rabbit Polyclonal |
Gene | C9orf85 |
Conjugate | Unconjugated |
Supplier Page | Shop |