Anti-C9orf85 antibody
| Name | Anti-C9orf85 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122955 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 39-88 (KLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCR P) of Mouse C9orf85 (NP_079699) |
| Description | Rabbit Polyclonal |
| Gene | C9orf85 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C9orf85 antibody (ab122955) at 1 µg/ml + Mouse heart lysate at 10 µg