Anti-CA7 antibody
| Name | Anti-CA7 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133926 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 90-139 ( YRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASA ) of Human CA7 (NP_005173) |
| Description | Rabbit Polyclonal |
| Gene | CA7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CA7 antibody (ab133926) at 1 µg/ml + Human fetal bladder lysate at 10 µg