Anti-CAMK 1D beta antibody
| Name | Anti-CAMK 1D beta antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab22043 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | Synthetic peptide: SSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFA conjugated to KLH, corresponding to N terminal amino acids 10-50 of Human CAMK 1D beta |
| Description | Rabbit Polyclonal |
| Gene | CAMK1D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CAMK 1D beta antibody (ab22043) at 2 µg/mlPerformed under reducing conditions.