Anti-CAPZA3 antibody
| Name | Anti-CAPZA3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89978 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (TLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC A) of Human CAPZA3 (NP_201585) |
| Description | Rabbit Polyclonal |
| Gene | CAPZA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CAPZA3 antibody (ab89978) at 1 µg/ml + DU145 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution