Anti-Carbonic Anhydrase I antibody
| Name | Anti-Carbonic Anhydrase I antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86280 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Cat, Dog, Pig, Chimpanzee |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 ( ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS ) of Human Carbonic Anhydrase I (NP_001729) |
| Description | Rabbit Polyclonal |
| Gene | Car1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Carbonic Anhydrase I antibody (ab86280) at 1 µg/ml (5% skim milk/ PBS buffer) + Placenta lysate at 10 µg with gel concentration: 12%SecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution