Anti-CARKD antibody
| Name | Anti-CARKD antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82820 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Yeast |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 143-192 ( RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA ) of Human CARKD; NP_060680 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | CARKD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CARKD antibody (ab82820) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 Cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution