Anti-CCDC138 antibody
| Name | Anti-CCDC138 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83826 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | A synthetic peptide corresponding to a region within the N-terminal sequence 2-51 ( EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG ) of Human CCDC138 (NP_659415) |
| Description | Rabbit Polyclonal |
| Gene | CCDC138 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CCDC138 antibody (ab83826) at 1 µg/ml (in 5% skim milk / PBS buffer) + 10ug 721_B cell lysateSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution