Anti-CCDC63 antibody
| Name | Anti-CCDC63 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89730 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide designed within residues: EDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSHD , corresponding to amino acids 324-373 of human CCDC63 (NP_689804) |
| Description | Rabbit Polyclonal |
| Gene | CCDC63 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CCDC63 antibody (ab89730) at 1 µg/ml + COLO205 cell lyate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution