Anti-CCDC87 antibody
| Name | Anti-CCDC87 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99061 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 ( MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL ) of Human CCDC87 (NP_060689) |
| Description | Rabbit Polyclonal |
| Gene | CCDC87 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CCDC87 antibody (ab99061) at 1 µg/ml + MCF7 cell lysate at 10 µg