Anti-CD153 antibody
| Name | Anti-CD153 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128262 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 55-104 ( ATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQV ) of Human CD153 (NP_001235) |
| Description | Rabbit Polyclonal |
| Gene | TNFSF8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CD153 antibody (ab128262) at 1 µg/ml + Human fetal kidney lysate at 10 µg