Anti-CD252 antibody
| Name | Anti-CD252 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108083 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 111-160 ( QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL ) of human CD252 (NP_003317) |
| Description | Rabbit Polyclonal |
| Gene | TNFSF4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CD252 antibody (ab108083) at 1 µg/ml + 293T cell lysate at 10 µg