Name | ZDHHC21 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4550 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV |
Purity/Format | Affinity purified |
Blocking Peptide | ZDHHC21 Blocking Peptide |
Description | Rabbit polyclonal ZDHHC21 antibody raised against the middle region of ZDHHC21 |
Gene | ZDHHC21 |
Supplier Page | Shop |