| Name | ZDHHC21 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4550 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZDHHC21 Blocking Peptide |
| Description | Rabbit polyclonal ZDHHC21 antibody raised against the middle region of ZDHHC21 |
| Gene | ZDHHC21 |
| Supplier Page | Shop |