Name | SFTPC antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7062 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI |
Purity/Format | Affinity purified |
Blocking Peptide | SFTPC Blocking Peptide |
Description | Rabbit polyclonal SFTPC antibody raised against the N terminal of SFTPC |
Gene | SFTPC |
Supplier Page | Shop |