SFTPC antibody

Name SFTPC antibody
Supplier Fitzgerald
Catalog 70R-7062
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI
Purity/Format Affinity purified
Blocking Peptide SFTPC Blocking Peptide
Description Rabbit polyclonal SFTPC antibody raised against the N terminal of SFTPC
Gene SFTPC
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.