| Name | RNF165 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1152 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RNF165 Blocking Peptide |
| Description | Rabbit polyclonal RNF165 antibody raised against the N terminal of RNF165 |
| Gene | RNF165 |
| Supplier Page | Shop |