PPAPDC1B antibody

Name PPAPDC1B antibody
Supplier Fitzgerald
Catalog 70R-6708
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen PPAPDC1B antibody was raised using the middle region of PPAPDC1B corresponding to a region with amino acids KLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSFAF
Purity/Format Affinity purified
Blocking Peptide PPAPDC1B Blocking Peptide
Description Rabbit polyclonal PPAPDC1B antibody raised against the middle region of PPAPDC1B
Gene PPAPDC1B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.