| Name | PLAC1L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5416 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PLAC1L antibody was raised using the middle region of PLAC1L corresponding to a region with amino acids YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW |
| Purity/Format | Affinity purified |
| Blocking Peptide | PLAC1L Blocking Peptide |
| Description | Rabbit polyclonal PLAC1L antibody raised against the middle region of PLAC1L |
| Gene | OOSP2 |
| Supplier Page | Shop |