Name | PLAC1L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5416 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PLAC1L antibody was raised using the middle region of PLAC1L corresponding to a region with amino acids YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW |
Purity/Format | Affinity purified |
Blocking Peptide | PLAC1L Blocking Peptide |
Description | Rabbit polyclonal PLAC1L antibody raised against the middle region of PLAC1L |
Gene | OOSP2 |
Supplier Page | Shop |