| Name | IFIT3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3590 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY |
| Purity/Format | Affinity purified |
| Blocking Peptide | IFIT3 Blocking Peptide |
| Description | Rabbit polyclonal IFIT3 antibody raised against the N terminal of IFIT3 |
| Gene | IFIT3 |
| Supplier Page | Shop |