| Name | KLHDC8A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1409 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KLHDC8A antibody was raised using the C terminal of KLHDC8A corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KLHDC8A Blocking Peptide |
| Description | Rabbit polyclonal KLHDC8A antibody raised against the C terminal of KLHDC8A |
| Gene | KLHDC8A |
| Supplier Page | Shop |