| Name | FBXO16 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3782 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | FBXO16 Blocking Peptide |
| Description | Rabbit polyclonal FBXO16 antibody raised against the N terminal of FBXO16 |
| Gene | FBXO16 |
| Supplier Page | Shop |