| Name | NUP98 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5608 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF |
| Purity/Format | Affinity purified |
| Blocking Peptide | NUP98 Blocking Peptide |
| Description | Rabbit polyclonal NUP98 antibody raised against the N terminal of NUP98 |
| Gene | NUP98 |
| Supplier Page | Shop |