Name | STRAP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1056 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | STRAP antibody was raised using the C terminal of STRAP corresponding to a region with amino acids ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | STRAP Blocking Peptide |
Description | Rabbit polyclonal STRAP antibody raised against the C terminal of STRAP |
Gene | STRAP |
Supplier Page | Shop |