| Name | RBM42 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4966 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RBM42 antibody was raised using the C terminal of RBM42 corresponding to a region with amino acids DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM42 Blocking Peptide |
| Description | Rabbit polyclonal RBM42 antibody raised against the C terminal of RBM42 |
| Gene | RBM42 |
| Supplier Page | Shop |