| Name | ALOX15B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2884 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ALOX15B antibody was raised using the N terminal of ALOX15B corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALOX15B Blocking Peptide |
| Description | Rabbit polyclonal ALOX15B antibody raised against the N terminal of ALOX15B |
| Gene | ALOX15B |
| Supplier Page | Shop |