NAT8B antibody

Name NAT8B antibody
Supplier Fitzgerald
Catalog 70R-6933
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NAT8B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA
Purity/Format Affinity purified
Blocking Peptide NAT8B Blocking Peptide
Description Rabbit polyclonal NAT8B antibody
Gene NAT8B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.