| Name | NRCAM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6388 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK |
| Purity/Format | Affinity purified |
| Blocking Peptide | NRCAM Blocking Peptide |
| Description | Rabbit polyclonal NRCAM antibody raised against the N terminal of NRCAM |
| Gene | NRCAM |
| Supplier Page | Shop |