| Name | PFKL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1248 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PFKL Blocking Peptide |
| Description | Rabbit polyclonal PFKL antibody raised against the middle region of PFKL |
| Gene | PFKL |
| Supplier Page | Shop |