| Name | CCDC25 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3622 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CCDC25 Blocking Peptide |
| Description | Rabbit polyclonal CCDC25 antibody raised against the middle region of CCDC25 |
| Gene | CCDC25 |
| Supplier Page | Shop |