| Name | ASB5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5995 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ASB5 antibody was raised using the C terminal of ASB5 corresponding to a region with amino acids LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC |
| Purity/Format | Affinity purified |
| Blocking Peptide | ASB5 Blocking Peptide |
| Description | Rabbit polyclonal ASB5 antibody raised against the C terminal of ASB5 |
| Gene | ASB5 |
| Supplier Page | Shop |