IGSF1 antibody

Name IGSF1 antibody
Supplier Fitzgerald
Catalog 70R-6035
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC
Purity/Format Affinity purified
Blocking Peptide IGSF1 Blocking Peptide
Description Rabbit polyclonal IGSF1 antibody raised against the middle region of IGSF1
Gene IGSF1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.