| Name | LOC51035 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3269 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LOC51035 antibody was raised using the middle region of LOC51035 corresponding to a region with amino acids RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF |
| Purity/Format | Affinity purified |
| Blocking Peptide | LOC51035 Blocking Peptide |
| Description | Rabbit polyclonal LOC51035 antibody raised against the middle region of LOC51035 |
| Gene | UBXN1 |
| Supplier Page | Shop |