| Name | FAM55D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1827 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Rat, Dog |
| Antigen | FAM55D antibody was raised using the C terminal of FAM55D corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FAM55D Blocking Peptide |
| Description | Rabbit polyclonal FAM55D antibody raised against the C terminal of FAM55D |
| Gene | NXPE4 |
| Supplier Page | Shop |